ARG59432

anti-ABCG8 antibody

anti-ABCG8 antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes ABCG8
Tested Reactivity Hu, Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name ABCG8
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 328-371 of Human ABCG8. (DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED)
Conjugation Un-conjugated
Alternate Names Sterolin-2; GBD4; STSL; ATP-binding cassette sub-family G member 8

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 155192 Rat ABCG8

GeneID: 64241 Human ABCG8

GeneID: 67470 Mouse ABCG8

Gene Symbol ABCG8
Gene Full Name ATP-binding cassette, sub-family G (WHITE), member 8
Background The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions to exclude non-cholesterol sterol entry at the intestinal level, promote excretion of cholesterol and sterols into bile, and to facilitate transport of sterols back into the intestinal lumen. It is expressed in a tissue-specific manner in the liver, intestine, and gallbladder. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG5. Mutations in this gene may contribute to sterol accumulation and atherosclerosis, and have been observed in patients with sitosterolemia. [provided by RefSeq, Jul 2008]
Function Transporter that appears to play an indispensable role in the selective transport of the dietary cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile. [UniProt]
Cellular Localization Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. [UniProt]
Calculated MW 76 kDa

Images (1) Click the Picture to Zoom In

  • ARG59432 anti-ABCG8 antibody WB image

    Western blot: Rat liver, Mouse liver and Human placenta lysates stained with ARG59432 anti-ABCG8 antibody at 0.5 µg/ml dilution.