ARG41270
anti-ACTR1B / ARP1B antibody
anti-ACTR1B / ARP1B antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes ACTR1B / ARP1B |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Yeast, Zfsh |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | ACTR1B / ARP1B |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human ACTR1B / ARP1B. (within the following region: VGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL) |
| Conjugation | Un-conjugated |
| Alternate Names | PC3; Actin-related protein 1B; CTRN2; Beta-centractin; ARP1B |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 85% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | 293T | ||||
| Observed Size | ~ 45 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | ACTR1B |
| Gene Full Name | ARP1 actin-related protein 1 homolog B, centractin beta (yeast) |
| Background | This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex. [provided by RefSeq, Aug 2008] |
| Function | Component of a multi-subunit complex involved in microtubule based vesicle motility. It is associated with the centrosome. [UniProt] |
| Cellular Localization | Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. [UniProt] |
| Calculated MW | 42 kDa |
Images (1) Click the Picture to Zoom In
-
ARG41270 anti-ACTR1B / ARP1B antibody WB image
Western blot: 293T cell lysate stained with ARG41270 anti-ACTR1B / ARP1B antibody at 0.2 - 1 µg/ml dilution.
