ARG42741
anti-B3GNT8 antibody
anti-B3GNT8 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes B3GNT8 |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | B3GNT8 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 360-397 of Human B3GNT8. (ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC) |
| Conjugation | Un-conjugated |
| Alternate Names | Beta-1,3-N-acetylglucosaminyltransferase 8; BGnT-8; B3GALT7; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8; EC 2.4.1.-; Beta3Gn-T8; Beta-1,3-Gn-T8; beta3Gn-T8; BGALT15 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Observed Size | ~ 45 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q7Z7M8 Human UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 |
|---|---|
| Gene Symbol | B3GNT8 |
| Gene Full Name | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 |
| Function | Beta-1,3-N-acetylglucosaminyltransferase that plays a role in the elongation of specific branch structures of multiantennary N-glycans. Has strong activity towards tetraantennary N-glycans and 2,6 triantennary glycans. [UniProt] |
| Cellular Localization | Golgi apparatus membrane; Single-pass type II membrane protein. [UniProt] |
| Calculated MW | 43 kDa |
Images (2) Click the Picture to Zoom In
-
ARG42741 anti-B3GNT8 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human mammary cancer tissue stained with ARG42741 anti-B3GNT8 antibody.
-
ARG42741 anti-B3GNT8 antibody WB image
Western blot: 40 µg of HeLa whole cell lysate stained with ARG42741 anti-B3GNT8 antibody at 0.5 µg/ml dilution.
