ARG58309
anti-Bmi 1 antibody
anti-Bmi 1 antibody for Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Bmi 1 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Predict Reactivity | Bov |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Bmi 1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence in the middle region of Human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related Mouse sequence by four amino acids. |
| Conjugation | Un-conjugated |
| Alternate Names | PCGF4; RNF51; FLVI2/BMI1; flvi-2/bmi-1 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | BMI1 |
| Gene Full Name | BMI1 proto-oncogene, polycomb ring finger |
| Background | This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene. [provided by RefSeq, Sep 2015] |
| Function | Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility (PubMed:15386022, PubMed:16359901, PubMed:26151332, PubMed:16714294, PubMed:21772249, PubMed:25355358, PubMed:27827373). The complex composed of RNF2, UB2D3 and BMI1 binds nucleosomes, and has activity only with nucleosomal histone H2A (PubMed:21772249, PubMed:25355358). In the PRC1-like complex, regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2 (PubMed:15386022, PubMed:26151332, PubMed:21772249). [UniProt] |
| Cellular Localization | Nucleus. Cytoplasm. [UniProt] |
| Calculated MW | 37 kDa |
Images (3) Click the Picture to Zoom In
-
ARG58309 anti-Bmi 1 antibody WB image
Western blot: 0.5 ng of Recombinant Human Bmi1 protein stained with ARG58309 anti-Bmi 1 antibody at 0.5 µg/ml dilution.
-
ARG58309 anti-Bmi 1 antibody WB image
Western blot: 50 µg of sample under reducing conditions. Rat brain and Mouse brain lysates stained with ARG58309 anti-Bmi 1 antibody at 0.5 µg/ml dilution, overnight at 4°C.
-
ARG58309 anti-Bmi 1 antibody WB image
Western blot: 50 µg of Rat spleen, 40 µg of HT1080 whole cell lysate and 40 µg of HeLa whole cell lysate stained with ARG58309 anti-Bmi 1 antibody at 0.5 µg/ml dilution.
