ARG40155
anti-C1GALT1C1 / COSMC antibody
anti-C1GALT1C1 / COSMC antibody for Western blot and Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes C1GALT1C1 / COSMC |
|---|---|
| Tested Reactivity | Rat |
| Predict Reactivity | Hu, Ms, Cow, Dog, Gpig, Hrs, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | C1GALT1C1 / COSMC |
| Antigen Species | Rat |
| Immunogen | Synthetic peptide around the N-terminal region of Rat C1GALT1C1 / COSMC. (within the following region: SFQVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDT) |
| Conjugation | Un-conjugated |
| Alternate Names | TNPS; C1GalT2; Core 1 beta3-galactosyltransferase-specific molecular chaperone; COSMC; C1GALT2; HSPC067; Core 1 beta3-Gal-T2; Core 1 beta1,3-galactosyltransferase 2; MST143; C1GALT1-specific chaperone 1; C1Gal-T2; C38H2-L1; C38H2-like protein 1 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | C1GALT1C1 |
| Gene Full Name | C1GALT1-specific chaperone 1 |
| Background | This gene encodes a type II transmembrane protein that is similar to the core 1 beta1,3-galactosyltransferase 1, which catalyzes the synthesis of the core-1 structure, also known as Thomsen-Friedenreich antigen, on O-linked glycans. This gene product lacks the galactosyltransferase activity itself, but instead acts as a molecular chaperone required for the folding, stability and full activity of the core 1 beta1,3-galactosyltransferase 1. Mutations in this gene have been associated with Tn syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Dec 2009] |
| Function | Probable chaperone required for the generation of 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Probably acts as a specific molecular chaperone assisting the folding/stability of core 1 beta-3-galactosyltransferase (C1GALT1). [UniProt] |
| Cellular Localization | Membrane; Single-pass type II membrane protein. [UniProt] |
| Calculated MW | 36 kDa |
Images (1) Click the Picture to Zoom In
