ARG59186

anti-CCS / SOD4 antibody

anti-CCS / SOD4 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes CCS / SOD4
Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name CCS / SOD4
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 174-209 of Human CCS / SOD4. (DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR)
Conjugation Un-conjugated
Alternate Names Copper chaperone for superoxide dismutase; Superoxide dismutase copper chaperone

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 12460 Mouse CCS

GeneID: 84485 Rat CCS

GeneID: 9973 Human CCS

Gene Symbol CCS
Gene Full Name copper chaperone for superoxide dismutase
Background Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq, Jul 2008]
Function Delivers copper to copper zinc superoxide dismutase (SOD1). [UniProt]
Cellular Localization Cytoplasm. [UniProt]
Calculated MW 29 kDa
PTM Ubiquitinion by XIAP/BIRC4 leads to enhancement of its chaperone activity toward its physiologic target, SOD1, rather than proteasomal degradation. XIAP/BIRC4 preferentially ubiquitinates at Lys-241. [UniProt]

Images (2) Click the Picture to Zoom In

  • ARG59186 anti-CCS / SOD4 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human tonsil stained with ARG59186 anti-CCS / SOD4 antibody at 1 µg/ml dilution.

  • ARG59186 anti-CCS / SOD4 antibody WB image

    Western blot: Rat brain, Rat spleen, Mouse brain, Mouse spleen and 293T whole cell lysates stained with ARG59186 anti-CCS / SOD4 antibody at 0.5 µg/ml dilution.