ARG41697
anti-CEP85L antibody
anti-CEP85L antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CEP85L |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Cow, Dog, Hrs, Pig, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CEP85L |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human CEP85L. (within the following region: KAKALTSQLRTIGPSCLHDSMEMLRLEDKEINKKRSSTLDCKYKFESCSK) |
| Conjugation | Un-conjugated |
| Alternate Names | C6orf204; Serologically defined breast cancer antigen NY-BR-15; bA57K17.2; Centrosomal protein of 85 kDa-like; NY-BR-15 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 92%; Dog: 100%; Horse: 92%; Mouse: 100%; Pig: 85%; Rabbit: 100% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human fetal liver | ||||
| Observed Size | ~ 92 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q5SZL2 Human Centrosomal protein of 85 kDa-like |
|---|---|
| Gene Symbol | CEP85L |
| Gene Full Name | centrosomal protein 85kDa-like |
| Background | The protein encoded by this gene was identified as a breast cancer antigen. Nothing more is known of its function at this time. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2010] |
| Cellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Note=Subcellular experiments using a GFP-tagged system produced a weak signal, rendering it difficult to confirm centrosome association. [UniProt] |
| Calculated MW | 92 kDa |
Images (1) Click the Picture to Zoom In
