ARG59642
anti-COCH antibody
anti-COCH antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes COCH |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | COCH |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the C-terminal region of Human COCH. (within the following region: VAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRGICRDFLESQQ) |
| Conjugation | Un-conjugated |
| Alternate Names | COCH-5B2; COCH5B2; Cochlin; DFNA9 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | COCH |
| Gene Full Name | cochlin |
| Background | The protein encoded by this gene is highly conserved in human, mouse, and chicken, showing 94% and 79% amino acid identity of human to mouse and chicken sequences, respectively. Hybridization to this gene was detected in spindle-shaped cells located along nerve fibers between the auditory ganglion and sensory epithelium. These cells accompany neurites at the habenula perforata, the opening through which neurites extend to innervate hair cells. This and the pattern of expression of this gene in chicken inner ear paralleled the histologic findings of acidophilic deposits, consistent with mucopolysaccharide ground substance, in temporal bones from DFNA9 (autosomal dominant nonsyndromic sensorineural deafness 9) patients. Mutations that cause DFNA9 have been reported in this gene. Alternative splicing results in multiple transcript variants encoding the same protein. Additional splice variants encoding distinct isoforms have been described but their biological validities have not been demonstrated. [provided by RefSeq, Oct 2008] |
| Function | Plays a role in the control of cell shape and motility in the trabecular meshwork. [UniProt] |
| Cellular Localization | Secreted, extracellular space, extracellular matrix. [UniProt] |
| Calculated MW | 59 kDa |
| PTM | N-glycosylated. A 50 kDa form is created by proteolytic cleavage. [UniProt] |
Images (1) Click the Picture to Zoom In
