ARG42682
anti-CPM / Carboxypeptidase M antibody
anti-CPM / Carboxypeptidase M antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CPM / Carboxypeptidase M |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CPM / Carboxypeptidase M |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 286-316 of Human CPM / Carboxypeptidase M. (KYPREEKLPSFWNNNKASLIEYIKQVHLGVK) |
| Conjugation | Un-conjugated |
| Alternate Names | EC 3.4.17.12; CPM; Carboxypeptidase M |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | HepG2 | ||||
| Observed Size | ~ 65 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | CPM |
| Gene Full Name | carboxypeptidase M |
| Background | The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Jul 2008] |
| Function | Specifically removes C-terminal basic residues (Arg or Lys) from peptides and proteins. It is believed to play important roles in the control of peptide hormone and growth factor activity at the cell surface, and in the membrane-localized degradation of extracellular proteins. [UniProt] |
| Cellular Localization | Cell membrane; Lipid-anchor, GPI-anchor. [UniProt] |
| Calculated MW | 51 kDa |
Images (1) Click the Picture to Zoom In
