ARG58549

anti-CSTF2 / CstF 64 antibody

anti-CSTF2 / CstF 64 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes CSTF2 / CstF 64
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name CSTF2 / CstF 64
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human CSTF2 / CstF 64. (within the following sequence: VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA)
Conjugation Un-conjugated
Alternate Names CstF-64; CF-1 64 kDa subunit; Cleavage stimulation factor 64 kDa subunit; CSTF 64 kDa subunit; Cleavage stimulation factor subunit 2

Application Instructions

Predict Reactivity Note Predicted homology based on immunogen sequence: Cow: 85%; Dog: 85%; Guinea Pig: 86%; Horse: 86%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Application Suggestion
Tested Application Dilution
IHC-P4 - 8 µg/ml
WB0.2 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control 293T

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 1478 Human CSTF2

Swiss-port # P33240 Human Cleavage stimulation factor subunit 2

Gene Symbol CSTF2
Gene Full Name cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa
Background This gene encodes a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs. [provided by RefSeq, Jul 2008]
Function One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. This subunit is directly involved in the binding to pre-mRNAs (By similarity). [UniProt]
Calculated MW 61 kDa

Images (4) Click the Picture to Zoom In

  • ARG58549 anti-CSTF2 / CstF 64 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung stained with ARG58549 anti-CSTF2 / CstF 64 antibody at 4 - 8 µg/ml dilution. Magnification: 400X.

  • ARG58549 anti-CSTF2 / CstF 64 antibody WB image

    Western blot: 293T cell lysate stained with ARG58549 anti-CSTF2 / CstF 64 antibody at 0.2 - 1 µg/ml dilution.

  • ARG58549 anti-CSTF2 / CstF 64 antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and paraffin-embedded Human testis stained with ARG58549 anti-CSTF2 / CstF 64 antibody at 1:100 dilution. Magnification: 20X.

  • ARG58549 anti-CSTF2 / CstF 64 antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and paraffin-embedded Human tonsil stained with ARG58549 anti-CSTF2 / CstF 64 antibody at 1:100 dilution. Magnification: 20X.