ARG58549
anti-CSTF2 / CstF 64 antibody
anti-CSTF2 / CstF 64 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CSTF2 / CstF 64 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CSTF2 / CstF 64 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human CSTF2 / CstF 64. (within the following sequence: VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA) |
| Conjugation | Un-conjugated |
| Alternate Names | CstF-64; CF-1 64 kDa subunit; Cleavage stimulation factor 64 kDa subunit; CSTF 64 kDa subunit; Cleavage stimulation factor subunit 2 |
Application Instructions
| Predict Reactivity Note | Predicted homology based on immunogen sequence: Cow: 85%; Dog: 85%; Guinea Pig: 86%; Horse: 86%; Mouse: 86%; Rabbit: 100%; Rat: 93% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | 293T |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P33240 Human Cleavage stimulation factor subunit 2 |
|---|---|
| Gene Symbol | CSTF2 |
| Gene Full Name | cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa |
| Background | This gene encodes a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs. [provided by RefSeq, Jul 2008] |
| Function | One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. This subunit is directly involved in the binding to pre-mRNAs (By similarity). [UniProt] |
| Calculated MW | 61 kDa |
Images (4) Click the Picture to Zoom In
-
ARG58549 anti-CSTF2 / CstF 64 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung stained with ARG58549 anti-CSTF2 / CstF 64 antibody at 4 - 8 µg/ml dilution. Magnification: 400X.
-
ARG58549 anti-CSTF2 / CstF 64 antibody WB image
Western blot: 293T cell lysate stained with ARG58549 anti-CSTF2 / CstF 64 antibody at 0.2 - 1 µg/ml dilution.
-
ARG58549 anti-CSTF2 / CstF 64 antibody IHC-P image
Immunohistochemistry: Formalin-fixed and paraffin-embedded Human testis stained with ARG58549 anti-CSTF2 / CstF 64 antibody at 1:100 dilution. Magnification: 20X.
-
ARG58549 anti-CSTF2 / CstF 64 antibody IHC-P image
Immunohistochemistry: Formalin-fixed and paraffin-embedded Human tonsil stained with ARG58549 anti-CSTF2 / CstF 64 antibody at 1:100 dilution. Magnification: 20X.
