ARG59641
anti-CTNS antibody
anti-CTNS antibody for Western blot and Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes CTNS |
|---|---|
| Tested Reactivity | Ms |
| Predict Reactivity | Hu, Rat, Cow, Dog, Hrs, Pig, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | CTNS |
| Antigen Species | Mouse |
| Immunogen | Synthetic peptide around the middle region of Mouse CTNS. (within the following region: GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP) |
| Conjugation | Un-conjugated |
| Alternate Names | Cystinosin; PQLC4; CTNS-LSB |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 93%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 92%; Rabbit: 85%; Rat: 92% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | CTNS |
| Gene Full Name | cystinosin, lysosomal cystine transporter |
| Background | This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009] |
| Function | Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an important role in melanin synthesis, possibly by preventing melanosome acidification and subsequent degradation of tyrosinase TYR. [UniProt] |
| Cellular Localization | Isoform 1: Lysosome membrane; Multi-pass membrane protein. Melanosome. Isoform 2: Lysosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 42 kDa |
Images (1) Click the Picture to Zoom In
-
ARG59641 anti-CTNS antibody WB image
Western blot: Mouse lung lysate stained with ARG59641 anti-CTNS antibody at 1 µg/ml dilution.
