ARG42954

anti-CYP27B1 antibody

anti-CYP27B1 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes CYP27B1
Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name CYP27B1
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 475-508 of Human CYP27B1. (HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR)
Conjugation Un-conjugated
Alternate Names P450c1; 25-OHD-1 alpha-hydroxylase; VDR; 25-hydroxyvitamin D; VD3 1A hydroxylase; CYP27B; Cytochrome P450 subfamily XXVIIB polypeptide 1; Cytochrome P450C1 alpha; CP2B; EC 1.14.13.13; CYP1alpha; Cytochrome p450 27B1; VDDR; CYP1; VDD1; Calcidiol 1-monooxygenase; Cytochrome P450VD1-alpha; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; VDDRI; PDDR; 3

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P1:200 - 1:1000
WB1:500 - 1:2000
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 57 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 114700 Rat CYP27B1

GeneID: 13115 Mouse CYP27B1

GeneID: 1594 Human CYP27B1

Gene Symbol CYP27B1
Gene Full Name cytochrome P450, family 27, subfamily B, polypeptide 1
Background This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I. [provided by RefSeq, Jul 2008]
Function A cytochrome P450 monooxygenase involved in vitamin D metabolism and in calcium and phosphorus homeostasis. Catalyzes the rate-limiting step in the activation of vitamin D in the kidney, namely the hydroxylation of 25-hydroxyvitamin D3/calcidiol at the C1alpha-position to form the hormonally active form of vitamin D3, 1alpha,25-dihydroxyvitamin D3/calcitriol that acts via the vitamin D receptor (VDR) (PubMed:10518789, PubMed:9486994, PubMed:22862690, PubMed:10566658, PubMed:12050193). Has 1alpha-hydroxylase activity on vitamin D intermediates of the CYP24A1-mediated inactivation pathway (PubMed:10518789, PubMed:22862690). Converts 24R,25-dihydroxyvitamin D3/secalciferol to 1-alpha,24,25-trihydroxyvitamin D3, an active ligand of VDR. Also active on 25-hydroxyvitamin D2 (PubMed:10518789). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via FDXR/adrenodoxin reductase and FDX1/adrenodoxin (PubMed:22862690). [UniProt]
Cellular Localization Mitochondrion membrane. [UniProt]
Calculated MW 57 kDa

Images (3) Click the Picture to Zoom In

  • ARG42954 anti-CYP27B1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Rat kidney tissue stained with ARG42954 anti-CYP27B1 antibody.

  • ARG42954 anti-CYP27B1 antibody WB image

    Western blot: 50 µg of Rat kidney, 50 µg of Mouse kidney, 40 µg of 293T whole cell lysates stained with ARG42954 anti-CYP27B1 antibody at 0.5 µg/ml dilution.

  • ARG42954 anti-CYP27B1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human kidney cancer tissue stained with ARG42954 anti-CYP27B1 antibody.