ARG59464

anti-EME1 antibody

anti-EME1 antibody for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes EME1
Tested Reactivity Hu, Rat
Tested Application FACS, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name EME1
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 520-561 of Human EME1. (DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ)
Conjugation Un-conjugated
Alternate Names MMS4 homolog; MMS4L; SLX2A; EC 3.1.22.-; Crossover junction endonuclease EME1; hMMS4

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 146956 Human EME1

Swiss-port # Q96AY2 Human Crossover junction endonuclease EME1

Gene Symbol EME1
Gene Full Name essential meiotic structure-specific endonuclease 1
Background This gene encodes a protein that complexes with methyl methanesulfonate-sensitive UV-sensitive 81 protein to form an endonuclease complex. The encoded protein interacts with specifc DNA structures including nicked Holliday junctions, 3'-flap structures and aberrant replication fork structures. This protein may be involved in repairing DNA damage and in maintaining genomic stability. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009]
Function Interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. May be required in mitosis for the processing of stalled or collapsed replication forks. [UniProt]
Cellular Localization Nucleus, nucleolus. Note=Recruited to regions of DNA damage in S-phase cells. [UniProt]
Calculated MW 63 kDa

Images (4) Click the Picture to Zoom In

  • ARG59464 anti-EME1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Rat intestine stained with ARG59464 anti-EME1 antibody.

  • ARG59464 anti-EME1 antibody WB image

    Western blot: 40 µg of HeLa, Jurkat and HuT whole cell lysates stained with ARG59464 anti-EME1 antibody at 0.5 µg/ml dilution.

  • ARG59464 anti-EME1 antibody FACS image

    Flow Cytometry: U2OS cells were blocked with 10% normal goat serum and then stained with ARG59464 anti-EME1 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.

  • ARG59464 anti-EME1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung cancer stained with ARG59464 anti-EME1 antibody.