ARG58590

anti-ETV4 / Pea3 antibody

anti-ETV4 / Pea3 antibody for Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes ETV4 / Pea3
Tested Reactivity Hu, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name ETV4 / Pea3
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 1-41 of Human ETV4 / Pea3. (MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD)
Conjugation Un-conjugated
Alternate Names Polyomavirus enhancer activator 3 homolog; Adenovirus E1A enhancer-binding protein; PEAS3; PEA3; Protein PEA3; E1AF; E1A-F; ETS translocation variant 4

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 2118 Human ETV4

Swiss-port # P43268 Human ETS translocation variant 4

Gene Symbol ETV4
Gene Full Name ets variant 4
Function Transcriptional activator that binds to the enhancer of the adenovirus E1A gene; the core-binding sequence is 5'[AC]GGA[AT]GT-3'. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 54 kDa
PTM Sumoylated; enhanced upon ERK/MAP kinase pathway activation, it positively regulates the transcriptional activator capacity. Sumoylation at Lys-96 probably requires phosphorylation at Ser-101. Transiently polysumoylated and desumoylated by SENP1. Sumoylation is a prerequisite to polyubiquitination which in turn increases proteasomal-mediated degradation. Probably polyubiquitinated by RNF4 and deubiquitinated by USP2. [UniProt]

Images (2) Click the Picture to Zoom In

  • ARG58590 anti-ETV4 / Pea3 antibody WB image

    Western blot: HeLa stained with ARG58590 anti-ETV4 / Pea3 antibody at 0.5 μg/mL dilution.

  • ARG58590 anti-ETV4 / Pea3 antibody WB image

    Western blot: Rat Lung stained with ARG58590 anti-ETV4 / Pea3 antibody at 0.5 μg/mL dilution.