ARG58590
anti-ETV4 / Pea3 antibody
anti-ETV4 / Pea3 antibody for Western blot and Human,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes ETV4 / Pea3 |
|---|---|
| Tested Reactivity | Hu, Rat |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | ETV4 / Pea3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 1-41 of Human ETV4 / Pea3. (MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD) |
| Conjugation | Un-conjugated |
| Alternate Names | Polyomavirus enhancer activator 3 homolog; Adenovirus E1A enhancer-binding protein; PEAS3; PEA3; Protein PEA3; E1AF; E1A-F; ETS translocation variant 4 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | ETV4 |
| Gene Full Name | ets variant 4 |
| Function | Transcriptional activator that binds to the enhancer of the adenovirus E1A gene; the core-binding sequence is 5'[AC]GGA[AT]GT-3'. [UniProt] |
| Cellular Localization | Nucleus. [UniProt] |
| Calculated MW | 54 kDa |
| PTM | Sumoylated; enhanced upon ERK/MAP kinase pathway activation, it positively regulates the transcriptional activator capacity. Sumoylation at Lys-96 probably requires phosphorylation at Ser-101. Transiently polysumoylated and desumoylated by SENP1. Sumoylation is a prerequisite to polyubiquitination which in turn increases proteasomal-mediated degradation. Probably polyubiquitinated by RNF4 and deubiquitinated by USP2. [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG58590 anti-ETV4 / Pea3 antibody WB image
Western blot: HeLa stained with ARG58590 anti-ETV4 / Pea3 antibody at 0.5 μg/mL dilution.
-
ARG58590 anti-ETV4 / Pea3 antibody WB image
Western blot: Rat Lung stained with ARG58590 anti-ETV4 / Pea3 antibody at 0.5 μg/mL dilution.
