ARG58615

anti-FAU antibody

anti-FAU antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes FAU
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name FAU
Antigen Species Human
Immunogen Synthetic peptide around the middle region of Human FAU. (within the following sequence: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS)
Conjugation Un-conjugated
Alternate Names MNSFbeta; RPS30; Fubi; S30; Fub1; FAU1; asr1; Ubiquitin-like protein FUBI

Application Instructions

Predict Reactivity Note Predicted homology based on immunogen sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Application Suggestion
Tested Application Dilution
IHC-P1:100
WB0.2 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control 721_B cells

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 2197 Human FAU

Swiss-port # P35544 Human Ubiquitin-like protein FUBI

Gene Symbol FAU
Gene Full Name Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
Background This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome and displays antimicrobial activity. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. [provided by RefSeq, Nov 2014]
Calculated MW 8 kDa

Images (5) Click the Picture to Zoom In

  • ARG58615 anti-FAU antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and paraffin-embedded Human liver stained with ARG58615 anti-FAU antibody at 1:100 dilution. Magnification: 20X.

  • ARG58615 anti-FAU antibody WB image

    Western blot: 721_B cell lysate stained with ARG58615 anti-FAU antibody at 0.2 - 1 µg/ml dilution.

  • ARG58615 anti-FAU antibody WB image

    Western blot: Jurkat cell lysate stained with ARG58615 anti-FAU antibody at 1 µg/ml dilution.

  • ARG58615 anti-FAU antibody WB image

    Western blot: MCF7 cell lysate stained with ARG58615 anti-FAU antibody at 1 µg/ml dilution.

  • ARG58615 anti-FAU antibody WB image

    Western blot: Human liver lysate stained with ARG58615 anti-FAU antibody at 1 µg/ml dilution.