ARG58710

anti-FMO1 antibody

anti-FMO1 antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes FMO1
Tested Reactivity Hu, Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name FMO1
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 334-363 of Human FMO1 (AFPFLDESVVKVEDGQASLYKYIFPAHLQK).
Conjugation Un-conjugated
Alternate Names Fetal hepatic flavin-containing monooxygenase 1; Dimethylaniline oxidase 1; Dimethylaniline monooxygenase [N-oxide-forming] 1; EC 1.14.13.8; FMO 1

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 14261 Mouse FMO1

GeneID: 2326 Human FMO1

GeneID: 25256 Rat FMO1

Gene Symbol FMO1
Gene Full Name flavin containing monooxygenase 1
Background Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]
Function This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Form I catalyzes the N-oxygenation of secondary and tertiary amines. [UniProt]
Cellular Localization Microsome membrane. Endoplasmic reticulum membrane. [UniProt]
Calculated MW 60 kDa

Images (1) Click the Picture to Zoom In

  • ARG58710 anti-FMO1 antibody WB image

    Western blot: 50 µg of Rat Liver, 50 µg of Mouse liver, 50 µg of Rat kidney, 50 µg of Mouse kidney and 40 µg of SMMC whole cell lysate stained with ARG58710 anti-FMO1 antibody at 0.5 µg/ml.