ARG58834

anti-FOXA3 antibody

anti-FOXA3 antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes FOXA3
Tested Reactivity Hu, Ms, Rat
Predict Reactivity Hm
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name FOXA3
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 291-324 of Human FOXA3 (ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF)
Conjugation Un-conjugated
Alternate Names TCF3G; Forkhead box protein A3; Fork head-related protein FKH H3; HNF-3-gamma; HNF-3G; TCF-3G; FKHH3; Hepatocyte nuclear factor 3-gamma; Transcription factor 3G; HNF3G

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 15377 Mouse FOXA3

GeneID: 25100 Rat FOXA3

GeneID: 3171 Human FOXA3

Gene Symbol FOXA3
Gene Full Name forkhead box A3
Background This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq, Jul 2008]
Function Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites (By similarity). Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis; binds to and activates transcription from the G6PC promoter. Binds to the CYP3A4 promoter and activates its transcription in cooperation with CEBPA. Binds to the CYP3A7 promoter together with members of the CTF/NF-I family. Involved in regulation of neuronal-specific transcription. May be involved in regulation of spermatogenesis. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 37 kDa

Images (1) Click the Picture to Zoom In

  • ARG58834 anti-FOXA3 antibody WB image

    Western blot: 50 µg of Rat liver, 50 µg of Rat pancreas, 50 µg of Mouse liver and 40 µg of HeLa cell lysates stained with ARG58834 anti-FOXA3 antibody at 0.5 µg/ml dilution.