ARG56858
anti-Filamin C antibody
anti-Filamin C antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Filamin C | 
|---|---|
| Tested Reactivity | Hu | 
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh | 
| Tested Application | WB | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Isotype | IgG | 
| Target Name | Filamin C | 
| Antigen Species | Human | 
| Immunogen | Synthetic peptide around the N-terminus of Human Filamin C. (VGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEP) | 
| Conjugation | Un-conjugated | 
| Alternate Names | ABP-280; FLNc; FLN2; Filamin-C; Gamma-filamin; ABP-280-like protein; ABPL; MPD4; Actin-binding-like protein; FLN-C; ABP280A; Filamin-2; MFM5; ABPA; ABP-L | 
Application Instructions
| Application Suggestion | 
									
  | 
							||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | HepG2 whole cell | 
Properties
| Form | Liquid | 
|---|---|
| Purification | Affinity purified. | 
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. | 
| Preservative | 0.09% (w/v) Sodium azide | 
| Stabilizer | 2% Sucrose | 
| Concentration | 0.5 - 1 mg/ml | 
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. | 
| Note | For laboratory research only, not for drug, diagnostic or other use. | 
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | FLNC | 
| Gene Full Name | filamin C, gamma | 
| Background | This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] | 
| Function | Muscle-specific filamin, which plays a central role in muscle cells, probably by functioning as a large actin-cross-linking protein. May be involved in reorganizing the actin cytoskeleton in response to signaling events, and may also display structural functions at the Z lines in muscle cells. Critical for normal myogenesis and for maintaining the structural integrity of the muscle fibers. [UniProt] | 
| Calculated MW | 291 kDa | 
| PTM | Ubiquitinated by FBXL22, leading to proteasomal degradation. | 
Images (1) Click the Picture to Zoom In
									
									
									
									
					
					