ARG41643
anti-GATA2 antibody
anti-GATA2 antibody for ChIP,Western blot and Human,Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes GATA2 |
|---|---|
| Tested Reactivity | Hu, Ms |
| Predict Reactivity | Cow, Rat, Dog, Gpig, Hrs, Rb |
| Tested Application | ChIP, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | GATA2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human GATA2. (within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA) |
| Conjugation | Un-conjugated |
| Alternate Names | DCML; GATA-binding protein 2; NFE1B; IMD21; Endothelial transcription factor GATA-2; MONOMAC |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Rabbit: 100%; Rat: 100% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | K562 | ||||||
| Observed Size | ~ 50 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Purification with Protein A. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # O09100 Mouse Endothelial transcription factor GATA-2 Swiss-port # P23769 Human Endothelial transcription factor GATA-2 |
|---|---|
| Gene Symbol | GATA2 |
| Gene Full Name | GATA binding protein 2 |
| Background | This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009] |
| Function | Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'. [UniProt] |
| Cellular Localization | Nucleus. [UniProt] |
| Calculated MW | 51 kDa |
Images (2) Click the Picture to Zoom In
