ARG41256
anti-GCM1 antibody
anti-GCM1 antibody for Western blot and Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes GCM1 |
|---|---|
| Tested Reactivity | Ms |
| Predict Reactivity | Hu, Rat, Cow, Dog, Gpig, Hrs, Zfsh |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | GCM1 |
| Antigen Species | Mouse |
| Immunogen | Synthetic peptide around the N-terminal region of Mouse GCM1. (within the following region: KEILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWA) |
| Conjugation | Un-conjugated |
| Alternate Names | GCMA; hGCMa; Glial cells missing homolog 1; Chorion-specific transcription factor GCMa; GCM motif protein 1 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea pig: 86%; Horse: 93%; Human: 86%; Rat: 93%; Zebrafish: 86% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Mouse heart | ||||
| Observed Size | ~ 50 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P70348 Mouse Chorion-specific transcription factor GCMa |
|---|---|
| Gene Symbol | GCM1 |
| Gene Full Name | glial cells missing homolog 1 (Drosophila) |
| Background | This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. [provided by RefSeq, Jul 2008] |
| Function | Transcription factor that is necessary for placental development. Binds to the trophoblast-specific element 2 (TSE2) of the aromatase gene enhancer. [UniProt] |
| Cellular Localization | Nucleus. [UniProt] |
| Calculated MW | 49 kDa |
| PTM | Polyubiquitinated in the presence of UBE2D2 and FBXW2 (in vitro). [UniProt] |
Images (1) Click the Picture to Zoom In
-
ARG41256 anti-GCM1 antibody WB image
Western blot: Mouse heart lysate stained with ARG41256 anti-GCM1 antibody at 0.2 - 1 µg/ml dilution.
