ARG10606
anti-GNAQ antibody
anti-GNAQ antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes GNAQ |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, ICC/IF, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | GNAQ |
| Antigen Species | Human |
| Immunogen | Synthetic peptide from Human GNAQ protein. (KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND) |
| Conjugation | Un-conjugated |
| Alternate Names | GAQ; SWS; CMC1; G-ALPHA-q; Guanine nucleotide-binding protein G(q) subunit alpha; Guanine nucleotide-binding protein alpha-q |
Application Instructions
| Application Suggestion |
|
||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Boil tissue sections in 10 mM Citrate buffer (pH 6.0) for 20 min * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | PBS, 0.025% Sodium azide and 2.5% BSA. |
| Preservative | 0.025% Sodium azide |
| Stabilizer | 2.5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | GNAQ |
| Gene Full Name | guanine nucleotide binding protein (G protein), q polypeptide |
| Background | This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.[provided by RefSeq, Nov 2010] |
| Function | Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells (in vitro) (By similarity). [UniProt] |
| Calculated MW | 42 kDa |
| PTM | (Microbial infection) Deamidated at Gln-209 by Photorhabdus asymbiotica toxin PAU_02230, blocking GTP hydrolysis of heterotrimeric GNAQ or GNA11 and G-alphai (GNAI1, GNAI2 or GNAI3) proteins, thereby activating RhoA. |
Images (6) Click the Picture to Zoom In
-
ARG10606 anti-GNAQ antibody ICC/IF image
Immunofluorescence: A431 cells stained with ARG10606 anti-GNAQ antibody (red). DAPI (blue) for nuclear staining.
-
ARG10606 anti-GNAQ antibody IHC-P image
Immunohistochemistry: Formalin-fixed and Paraffin-embedded Human prostate cancer tissue stained with ARG10606 anti-GNAQ antibody.
-
ARG10606 anti-GNAQ antibody WB image
Western blot: 1) Rat ovary, 2) Rat testis, 3) Mouse testis, 4) Human 22RV1 and 5) Human SKOV lysate stained with ARG10606 anti-GNAQ antibody.
-
ARG10606 anti-GNAQ antibody FACS image
Flow Cytometry: A431 cells were blocked with goat sera and stained with ARG10606 anti-GNAQ antibody at 1 µg/10^6 cells (blue); Cells alone (red); Isotype control (green).
-
ARG10606 anti-GNAQ antibody IHC-P image
Immunohistochemistry: Formalin-fixed and Paraffin-embedded Mouse testis tissue stained with ARG10606 anti-GNAQ antibody.
-
ARG10606 anti-GNAQ antibody IHC-P image
Immunohistochemistry: Formalin-fixed and Paraffin-embedded Rat ovary tissue stained with ARG10606 anti-GNAQ antibody.
