ARG58934
anti-GNAZ antibody
anti-GNAZ antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes GNAZ |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | GNAZ |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human GNAZ. (within the following region: LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT) |
| Conjugation | Un-conjugated |
| Alternate Names | Guanine nucleotide-binding protein G(z) subunit alpha; G(x) alpha chain; Gz-alpha |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | HepG2 |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P19086 Human Guanine nucleotide-binding protein G(z) subunit alpha |
|---|---|
| Gene Symbol | GNAZ |
| Gene Full Name | guanine nucleotide binding protein (G protein), alpha z polypeptide |
| Background | The protein encoded by this gene is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This encoded protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids. [provided by RefSeq, Jul 2008] |
| Function | Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. [UniProt] |
| Cellular Localization | Membrane; Lipid-anchor. [UniProt] |
| Calculated MW | 41 kDa |
Images (2) Click the Picture to Zoom In
-
ARG58934 anti-GNAZ antibody WB image
Western blot: HepG2 cell lysate stained with ARG58934 anti-GNAZ antibody at 0.2 - 1 µg/ml dilution.
-
ARG58934 anti-GNAZ antibody WB image
Western blot: Human fetal brain lysate stained with ARG58934 anti-GNAZ antibody at 1 µg/ml dilution.
