ARG58936
anti-GNGT2 antibody
anti-GNGT2 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes GNGT2 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Sheep |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | GNGT2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human GNGT2. (within the following region: KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS) |
| Conjugation | Un-conjugated |
| Alternate Names | GNG8; GNG9; GNGT8; G-GAMMA-8; G-GAMMA-C; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2; G gamma-C; G-gamma-8; G-gamma-9; Guanine nucleotide binding protein gamma transducing activity polypeptide 2 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea pig: 77%; Horse: 86%; Mouse: 86%; Rabbit: 92%; Rat: 85%; Sheep: 77% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | 293T |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # O14610 Human Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 |
|---|---|
| Gene Symbol | GNGT2 |
| Gene Full Name | guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 |
| Background | Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2010] |
| Function | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. [UniProt] |
| Cellular Localization | Cell membrane; Lipid-anchor; Cytoplasmic side. [UniProt] |
| Calculated MW | 8 kDa |
Images (1) Click the Picture to Zoom In
-
ARG58936 anti-GNGT2 antibody WB image
Western blot: 293T cell lysate stained with ARG58936 anti-GNGT2 antibody at 0.2 - 1 µg/ml dilution.
