ARG41396
anti-GPX7 antibody
anti-GPX7 antibody for Western blot and Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes GPX7 |
|---|---|
| Tested Reactivity | Rat |
| Predict Reactivity | Hu, Ms, Cow, Dog, Gpig, Hrs, Pig, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | GPX7 |
| Antigen Species | Rat |
| Immunogen | Synthetic peptide around the C-terminal region of Rat GPX7. (within the following region: RTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKV) |
| Conjugation | Un-conjugated |
| Alternate Names | GPx-7; GPX6; CL683; EC 1.11.1.9; GSHPx-7; Glutathione peroxidase 7; NPGPx |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Observed Size | ~ 21 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Gene Symbol | GPX7 |
|---|---|
| Gene Full Name | glutathione peroxidase 7 |
| Function | It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks. [UniProt] |
| Cellular Localization | Secreted. [UniProt] |
| Calculated MW | 21 kDa |
Images (1) Click the Picture to Zoom In
-
ARG41396 anti-GPX7 antibody WB image
Western blot: Rat heart lysate stained with ARG41396 anti-GPX7 antibody at 1 µg/ml dilution.
