ARG58831
anti-GRK6 antibody
anti-GRK6 antibody for Western blot and Human,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes GRK6 |
|---|---|
| Tested Reactivity | Hu, Rat |
| Predict Reactivity | Bov |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | GRK6 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 382-417 of Human GRK6 (QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR). |
| Conjugation | Un-conjugated |
| Alternate Names | G protein-coupled receptor kinase GRK6; G protein-coupled receptor kinase 6; EC 2.7.11.16; GPRK6 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P43250 Human G protein-coupled receptor kinase 6 |
|---|---|
| Gene Symbol | GRK6 |
| Gene Full Name | G protein-coupled receptor kinase 6 |
| Background | This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Function | Specifically phosphorylates the activated forms of G protein-coupled receptors. Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their desensitization. Seems to be involved in the desensitization of D2-like dopamine receptors in striatum and chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis (By similarity). Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor: LRP6 during Wnt signaling (in vitro). [UniProt] |
| Cellular Localization | Membrane; Lipid-anchor. [UniProt] |
| Calculated MW | 66 kDa |
| PTM | It is uncertain whether palmitoylation is on Cys-561 and/or Cys-562 and/or Cys-565. [UniProt] |
Images (1) Click the Picture to Zoom In
