ARG58780

anti-GSTM1 antibody

anti-GSTM1 antibody for Flow cytometry,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes GSTM1
Tested Reactivity Hu, Ms, Rat
Tested Application FACS, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name GSTM1
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK).
Conjugation Un-conjugated
Alternate Names GST HB subunit 4; MU-1; GST class-mu 1; GST1; Glutathione S-transferase Mu 1; GSTM1-1; GSTM1a-1a; MU; GTH4; EC 2.5.1.18; GSTM1b-1b; H-B; GTM1

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 14862 Mouse GSTM1

GeneID: 24423 Rat GSTM1

GeneID: 2944 Human GSTM1

Gene Symbol GSTM1
Gene Full Name glutathione S-transferase mu 1
Background Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008]
Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. [UniProt]
Cellular Localization Cytoplasm. [UniProt]
Calculated MW 26 kDa

Images (2) Click the Picture to Zoom In

  • ARG58780 anti-GSTM1 antibody WB image

    Western blot: 50 µg of samples under reducing conditions. Rat brain, Rat lung, Mouse stomach and Mouse kidney lysates stained with ARG58780 anti-GSTM1 antibody at 0.5 µg/ml, overnight at 4°C.

  • ARG58780 anti-GSTM1 antibody FACS image

    Flow Cytometry: HeLa cells were blocked with 10% normal goat serum and then stained with ARG58780 anti-GSTM1 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.