ARG59648
anti-HAL / Histidase antibody
anti-HAL / Histidase antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes HAL / Histidase |
---|---|
Tested Reactivity | Hu |
Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb, Zfsh |
Tested Application | IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | HAL / Histidase |
Antigen Species | Human |
Immunogen | Synthetic peptide around the N-terminal region of Human HAL. (within the following region: INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET) |
Conjugation | Un-conjugated |
Alternate Names | EC 4.3.1.3; HIS; Histidase; Histidine ammonia-lyase; HSTD |
Application Instructions
Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% | ||||||
---|---|---|---|---|---|---|---|
Application Suggestion |
|
||||||
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | HAL |
Gene Full Name | histidine ammonia-lyase |
Background | Histidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] |
Calculated MW | 73 kDa |
PTM | Contains an active site 4-methylidene-imidazol-5-one (MIO), which is formed autocatalytically by cyclization and dehydration of residues Ala-Ser-Gly. [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG59648 anti-HAL / Histidase antibody IHC-P image
Immunohistochemistry: Paraffin-embedded fetal liver tissue stained with ARG59648 anti-HAL / Histidase antibody at 1.25 µg/ml dilution.
-
ARG59648 anti-HAL / Histidase antibody WB image
Western blot: 721_B cell lysate stained with ARG59648 anti-HAL / Histidase antibody at 1 µg/ml dilution.