ARG43091
anti-HECTD3 antibody
anti-HECTD3 antibody for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes HECTD3 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | HECTD3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human HECTD3. (HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE) |
| Conjugation | Un-conjugated |
| Alternate Names | E3 ubiquitin-protein ligase HECTD3; EC 6.3.2.-; HECT domain-containing protein 3 |
Application Instructions
| Application Suggestion |
|
||||||||
|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||||
| Positive Control | Caco-2, Rat brain and Mouse brain | ||||||||
| Observed Size | ~ 97 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q3U487 Mouse E3 ubiquitin-protein ligase HECTD3 Swiss-port # Q5T447 Human E3 ubiquitin-protein ligase HECTD3 |
|---|---|
| Gene Symbol | HECTD3 |
| Gene Full Name | HECT domain containing E3 ubiquitin protein ligase 3 |
| Background | The protein encoded by this gene transfers ubiquitin from an E2 ubiquitin-conjugating enzyme to targeted substrates, leading to the degradation of those substrates. The encoded protein has been shown to transfer ubiquitin to TRIOBP to facilitate cell cycle progression, and to STX8. [provided by RefSeq, Dec 2012] |
| Function | E3 ubiquitin ligases accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of TRIOBP and its subsequent proteasomal degradation, thus facilitating cell cycle progression by regulating the turn-over of TRIOBP. Mediates also ubiquitination of STX8 (By similarity). [UniProt] |
| Cellular Localization | Cytoplasm, perinuclear region. [UniProt] |
| Calculated MW | 97 kDa |
Images (5) Click the Picture to Zoom In
-
ARG43091 anti-HECTD3 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43091 anti-HECTD3 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43091 anti-HECTD3 antibody WB image
Western blot: 50 µg of sample under reducing conditions. Caco-2, Rat brain and Mouse brain lysates stained with ARG43091 anti-HECTD3 antibody at 0.5 µg/ml dilution, overnight at 4°C.
-
ARG43091 anti-HECTD3 antibody FACS image
Flow Cytometry: A549 cells were blocked with 10% normal goat serum and then stained with ARG43091 anti-HECTD3 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG43091 anti-HECTD3 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43091 anti-HECTD3 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43091 anti-HECTD3 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse gaster tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43091 anti-HECTD3 antibody at 1 µg/ml dilution, overnight at 4°C.
