ARG10674
anti-IGFBP2 antibody
anti-IGFBP2 antibody for Western blot and Human,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes IGFBP2 |
|---|---|
| Tested Reactivity | Hu, Rat |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | IGFBP2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to the sequence at a.a 228-257 (QQELDQVLERISTMRLPDERGPLEHLYSLH) around the C-terminus of human IGFBP2 protein. |
| Conjugation | Un-conjugated |
| Alternate Names | IBP2; IGF-BP53; IGF-binding protein 2; IGFBP-2 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 1X PBS, 0.025% Sodium azide and 2.6% BSA |
| Preservative | 0.026% Sodium azide |
| Stabilizer | 2.6% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P12843 Rat Insulin-like growth factor-binding protein 2 Swiss-port # P18065 Human Insulin-like growth factor-binding protein 2 |
|---|---|
| Gene Symbol | IGFBP2 |
| Gene Full Name | Insulin Like Growth Factor Binding Protein 2 |
| Background | The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can remain intracellular, interacting with many different ligands. High expression levels of this protein promote the growth of several types of tumors and may be predictive of the chances of recovery of the patient. Several transcript variants, one encoding a secreted isoform and the others encoding nonsecreted isoforms, have been found for this gene. [provided by RefSeq, Sep 2015] |
| Function | Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. [UniProt] |
| Calculated MW | 35 kDa |
| PTM | O-glycosylated. |
Images (2) Click the Picture to Zoom In
