ARG40961

anti-IRF8 antibody

anti-IRF8 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes IRF8
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name IRF8
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human IRF8. (within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC)
Conjugation Un-conjugated
Alternate Names H-ICSBP; ICSBP; ICSBP1; IRF-8; IMD32A; IMD32B; Interferon consensus sequence-binding protein; Interferon regulatory factor 8

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Application Suggestion
Tested Application Dilution
IHC-PAssay-dependent
WB1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 3394 Human IRF8

Swiss-port # Q02556 Human Interferon regulatory factor 8

Gene Symbol IRF8
Gene Full Name interferon regulatory factor 8
Background Interferon consensus sequence-binding protein (ICSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. [provided by RefSeq, Jul 2008]
Function Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Plays a negative regulatory role in cells of the immune system. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF8 and activation of genes (By similarity). [UniProt]
Cellular Localization Nucleus. Cytoplasm. Note=In resting macrophages, localizes in the cytoplasm. Translocated in the nucleus upon IFN-gamma induction. [UniProt]
Calculated MW 48 kDa
PTM Ubiquitinated (PubMed:25122610). Ubiquitination by TRIM21 in macrophages, a process that is strongly increased upon interferon gamma stimulation, leds to the enhanced transcriptional activity of target cytokine genes (By similarity). Ubiquitination leads to its degradation by the proteasome (PubMed:25122610).

Sumoylated with SUMO3. Desumoylated by SENP1. [UniProt]

Images (3) Click the Picture to Zoom In

  • ARG40961 anti-IRF8 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human intestine tissue stained with ARG40961 anti-IRF8 antibody.

  • ARG40961 anti-IRF8 antibody WB image

    Western blot: Human DLD1 whole cell lysate stained with ARG40961 anti-IRF8 antibody at 1 µg/ml dilution.

  • ARG40961 anti-IRF8 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human liver tissue stained with ARG40961 anti-IRF8 antibody.