ARG58828
anti-LIFR antibody
anti-LIFR antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes LIFR |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Bov |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | LIFR |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 863-899 of Human LIFR (EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE). |
| Conjugation | Un-conjugated |
| Alternate Names | CD118; CD antigen CD118; STWS; SJS2; LIF receptor; Leukemia inhibitory factor receptor; SWS; LIF-R |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P42702 Human Leukemia inhibitory factor receptor |
|---|---|
| Gene Symbol | LIFR |
| Gene Full Name | leukemia inhibitory factor receptor alpha |
| Background | This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Function | Signal-transducing molecule. May have a common pathway with IL6ST. The soluble form inhibits the biological activity of LIF by blocking its binding to receptors on target cells. [UniProt] |
| Cellular Localization | Isoform 1: Cell membrane; Single-pass type I membrane protein. [UniProt] |
| Calculated MW | 124 kDa |
Images (1) Click the Picture to Zoom In
-
ARG58828 anti-LIFR antibody WB image
Western blot: 40 µg of SW620, COLO320 and HepG2 cell lysates stained with ARG58828 anti-LIFR antibody at 0.5 µg/ml dilution.
