ARG40923
anti-LMO1 antibody
anti-LMO1 antibody for Western blot and Human,Mouse,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes LMO1 |
---|---|
Tested Reactivity | Hu, Ms, Rat |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | LMO1 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 127-156 of Human LMO1. (DKFFLKNNMILCQMDYEEGQLNGTFESQVQ) |
Conjugation | Un-conjugated |
Alternate Names | RHOM1; LMO-1; TTG1; T-cell translocation protein 1; LIM domain only protein 1; RBTN1; Cysteine-rich protein TTG-1; Rhombotin-1 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | LMO1 |
Gene Full Name | LIM domain only 1 (rhombotin 1) |
Background | This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2012] |
Function | May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. [UniProt] |
Cellular Localization | Nucleus. [UniProt] |
Calculated MW | 18 kDa |
Images (1) Click the Picture to Zoom In