ARG40923

anti-LMO1 antibody

anti-LMO1 antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes LMO1
Tested Reactivity Hu, Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name LMO1
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 127-156 of Human LMO1. (DKFFLKNNMILCQMDYEEGQLNGTFESQVQ)
Conjugation Un-conjugated
Alternate Names RHOM1; LMO-1; TTG1; T-cell translocation protein 1; LIM domain only protein 1; RBTN1; Cysteine-rich protein TTG-1; Rhombotin-1

Application Instructions

Application Suggestion
Tested Application Dilution
WB1:500 - 1:2000
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 109594 Mouse LMO1

GeneID: 4004 Human LMO1

Swiss-port # P25800 Human Rhombotin-1

Swiss-port # Q924W9 Mouse Rhombotin-1

Gene Symbol LMO1
Gene Full Name LIM domain only 1 (rhombotin 1)
Background This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2012]
Function May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 18 kDa

Images (1) Click the Picture to Zoom In

  • ARG40923 anti-LMO1 antibody WB image

    Western blot: Rat brain, NIH/3T3 and HeLa whole cell lysates stained with ARG40923 anti-LMO1 antibody at 0.5 µg/ml dilution.