ARG43132
anti-LRTOMT antibody
anti-LRTOMT antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes LRTOMT |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | LRTOMT |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human LRTOMT. (RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL) |
| Conjugation | Un-conjugated |
| Alternate Names | Protein LRTOMT1; LRRC51; CFAP111; DFNB63; Leucine-rich repeat-containing protein 51 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||
| Observed Size | ~ 27 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Immunogen affinity purified. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # B6CZ62 Rat Transmembrane O-methyltransferase Swiss-port # Q96E66 Human Leucine-rich repeat-containing protein 51 |
|---|---|
| Gene Symbol | LRTOMT |
| Gene Full Name | leucine rich transmembrane and O-methyltransferase domain containing |
| Background | This gene has evolved in primates as a fusion of two ancestral neighboring genes, Lrrc51 and Tomt, which exist as two independent genes in rodents. The fusion gene contains some shared exons, but encodes structurally unrelated proteins, LRTOMT1 and LRTOMT2. Those variants that utilize the more centromere-proximal 3' terminal exon (short transcript form) encode LRTOMT1, while those variants that use a more centromere-distal 3' terminal exon (long transcript form) encode the LRTOMT2 protein. There is a small region within one of the exons of this gene that contains overlapping alternate reading frames for both LRTOMT1 and LRTOMT2. LRTOMT1 shares similarity with the protein encoded by mouse Lrrc51, while LRTOMT2 shares similarity with the protein encoded by mouse Tomt. Alternative splicing results in multiple transcript variants, encoding different isoforms of both LRTOMT1 and LRTOMT2. The LRTOMT1 protein is a leucine-rich repeat-containing protein, while the LRTOMT2 protein is a catechol-O-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to a hydroxyl group of catechols and is essential for auditory and vestibular function. Mutations in this gene have been associated with nonsyndromic deafness. [provided by RefSeq, Nov 2017] |
| Cellular Localization | Cytoplasm. [UniProt] |
| Calculated MW | 22 kDa |
Images (7) Click the Picture to Zoom In
-
ARG43132 anti-LRTOMT antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human placenta tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43132 anti-LRTOMT antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43132 anti-LRTOMT antibody WB image
Western blot: 50 µg of sample under reducing conditions. Human placenta, MCF-7, HeLa, Caco-2, K562, U2OS and THP-1 whole cell lysates stained with ARG43132 anti-LRTOMT antibody at 0.5 µg/ml dilution, overnight at 4°C.
-
ARG43132 anti-LRTOMT antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43132 anti-LRTOMT antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43132 anti-LRTOMT antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse brain tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43132 anti-LRTOMT antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43132 anti-LRTOMT antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse brain tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43132 anti-LRTOMT antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43132 anti-LRTOMT antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat brain tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43132 anti-LRTOMT antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG43132 anti-LRTOMT antibody WB image
Western blot: 50 µg of sample under reducing conditions. Rat brain, Rat ovary, Rat heart, Rat lung, Mouse brain and Mouse lung lysates stained with ARG43132 anti-LRTOMT antibody at 0.5 µg/ml dilution, overnight at 4°C.
