ARG40379
anti-MAOB antibody
anti-MAOB antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MAOB |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MAOB |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 448-484 of Human MAOB. (REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER) |
| Conjugation | Un-conjugated |
| Alternate Names | MAO-B; Monoamine oxidase type B; Amine oxidase [flavin-containing] B; EC 1.4.3.4 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||
| Observed Size | ~ 60 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | MAOB |
| Gene Full Name | monoamine oxidase B |
| Background | The protein encoded by this gene belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. [provided by RefSeq, Jul 2008] |
| Function | Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine. [UniProt] |
| Cellular Localization | Mitochondrion outer membrane; Single-pass type IV membrane protein; Cytoplasmic side. [UniProt] |
| Calculated MW | 59 kDa |
Images (5) Click the Picture to Zoom In
-
ARG40379 anti-MAOB antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse intestine stained with ARG40379 anti-MAOB antibody.
-
ARG40379 anti-MAOB antibody WB image
Western blot: 50 µg of Rat cardiac muscle, 50 µg of Rat kidney, 50 µg of Rat intestine, 50 µg of Mouse kidney, 50 µg of Mouse intestine, 50 µg of Mouse cardiac muscle, 40 µg of HepG2, 40 µg of HeLa and 40 µg of COLO320 whole cell lysates stained with ARG40379 anti-MAOB antibody at 0.5 µg/ml dilution.
-
ARG40379 anti-MAOB antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat intestine stained with ARG40379 anti-MAOB antibody.
-
ARG40379 anti-MAOB antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung cancer tissue stained with ARG40379 anti-MAOB antibody.
-
ARG40379 anti-MAOB antibody WB image
Western blot: 50 µg of Rat brain and Mouse brain lysates stained with ARG40379 anti-MAOB antibody at 0.5 µg/ml dilution.
