ARG40405
anti-MAT1A antibody
anti-MAT1A antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MAT1A |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MAT1A |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human MAT1A. (within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE) |
| Conjugation | Un-conjugated |
| Alternate Names | SAMS1; MAT 1; MAT; Methionine adenosyltransferase I/III; MAT-I/III; Methionine adenosyltransferase 1; MATA1; AdoMet synthase 1; EC 2.5.1.6; SAMS; S-adenosylmethionine synthase isoform type-1 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | Jurkat | ||||||
| Observed Size | 48 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Purification with Protein A. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q00266 Human S-adenosylmethionine synthase isoform type-1 |
|---|---|
| Gene Symbol | MAT1A |
| Gene Full Name | methionine adenosyltransferase I, alpha |
| Background | This gene catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. The encoded protein is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in this gene are associated with methionine adenosyltransferase deficiency. [provided by RefSeq, Jul 2008] |
| Function | Catalyzes the formation of S-adenosylmethionine from methionine and ATP. [UniProt] |
| Calculated MW | 44 kDa |
| PTM | S-nitrosylation of Cys-120 inactivates the enzyme. An intrachain disulfide bond can be formed. The protein structure shows that the relevant Cys residues are in a position that would permit formation of a disulfide bond. [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG40405 anti-MAT1A antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human kidney (Epithelial cells of renal tubule) stained with ARG40405 anti-MAT1A antibody at 4 - 8 µg/ml dilution.
-
ARG40405 anti-MAT1A antibody WB image
Western blot: Jurkat cell lysate stained with ARG40405 anti-MAT1A antibody at 1.25 µg/ml dilution.
