ARG41330
anti-MCOLN1 / TRPML1 antibody
anti-MCOLN1 / TRPML1 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MCOLN1 / TRPML1 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MCOLN1 / TRPML1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human MCOLN1 / TRPML1. (within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV) |
| Conjugation | Un-conjugated |
| Alternate Names | ML4; MLIV; Mucolipidin; TRPM-L1; MG-2; TRP-ML1; Mucolipin-1; MST080; MSTP080; TRPML1 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea pig: 93%; Horse: 93%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human fetal lung | ||||
| Observed Size | ~ 65 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | MCOLN1 |
| Gene Full Name | mucolipin 1 |
| Background | This gene encodes a memberof the transient receptor potential (TRP) cation channel gene family. The transmembrane protein localizes to intracellular vesicular membranes including lysosomes, and functions in the late endocytic pathway and in the regulation of lysosomal exocytosis. The channel is permeable to Ca(2+), Fe(2+), Na(+), K(+), and H(+), and is modulated by changes in Ca(2+) concentration. Mutations in this gene result in mucolipidosis type IV. [provided by RefSeq, Oct 2009] |
| Function | Cation channel probably playing a role in the endocytic pathway and in the control of membrane trafficking of proteins and lipids. Could play a major role in Ca(2+) transport regulating lysosomal exocytosis. [UniProt] |
| Cellular Localization | Late endosome membrane; Lysosome membrane; Cytoplasmic vesicle membrane; Cell projection, phagocytic cup. Cytoplasmic vesicle, phagosome membrane; Cell membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 65 kDa |
Images (1) Click the Picture to Zoom In
