ARG43092

anti-MCUR1 antibody

anti-MCUR1 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes MCUR1
Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name MCUR1
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human MCUR1. (ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE)
Conjugation Un-conjugated
Alternate Names CCDC90A; C6orf79; Mitochondrial calcium uniporter regulator 1; Coiled-coil domain-containing protein 90A, mitochondrial

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P1:200 - 1:1000
WB1:500 - 1:2000
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 40 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 63933 Human MCUR1

GeneID: 76137 Mouse MCUR1

Swiss-port # Q96AQ8 Human Mitochondrial calcium uniporter regulator 1

Swiss-port # Q9CXD6 Mouse Mitochondrial calcium uniporter regulator 1

Gene Symbol MCUR1
Gene Full Name mitochondrial calcium uniporter regulator 1
Function Key regulator of mitochondrial calcium uniporter (MCU) required for calcium entry into mitochondrion (PubMed:23178883, PubMed:26445506, PubMed:27184846, PubMed:26976564). Plays a direct role in uniporter-mediated calcium uptake via a direct interaction with MCU (PubMed:23178883). Probably involved in the assembly of the membrane components of the uniporter complex (uniplex) (PubMed:27184846). [UniProt]
Cellular Localization Mitochondrion inner membrane; Multi-pass membrane protein. [UniProt]
Calculated MW 40 kDa

Images (6) Click the Picture to Zoom In

  • ARG43092 anti-MCUR1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human oesophagus squama cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43092 anti-MCUR1 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG43092 anti-MCUR1 antibody WB image

    Western blot: 50 µg of sample under reducing conditions. HeLa, MDA-MB-231, HL-60, MDA-MB-453, A431, Caco-2, Rat spleen, Mouse lung and Ana-1 whole cell lysates stained with ARG43092 anti-MCUR1 antibody at 0.5 µg/ml dilution, overnight at 4°C.

  • ARG43092 anti-MCUR1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human ovary cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43092 anti-MCUR1 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG43092 anti-MCUR1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human placenta tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43092 anti-MCUR1 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG43092 anti-MCUR1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human tonsil tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43092 anti-MCUR1 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG43092 anti-MCUR1 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG43092 anti-MCUR1 antibody at 1 µg/ml dilution, overnight at 4°C.