ARG59148
anti-MEGF6 antibody
anti-MEGF6 antibody for Western blot and Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MEGF6 |
|---|---|
| Tested Reactivity | Rat |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MEGF6 |
| Antigen Species | Rat |
| Immunogen | Synthetic peptide around the middle region of Rat MEGF6. (within the following region: RRGCTSLEESVVDLDGRLPFVRPLPHIAVLRDELPRLFQDDYGAEEEAAA) |
| Conjugation | Un-conjugated |
| Alternate Names | Multiple EGF-like domains protein 6; EGF-like protein 3; EGFL3; Epidermal growth factor-like protein 3; Multiple epidermal growth factor-like domains protein 6 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Rat lung |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # O88281 Rat Multiple epidermal growth factor-like domains protein 6 |
|---|---|
| Gene Symbol | MEGF6 |
| Gene Full Name | multiple EGF-like-domains 6 |
| Cellular Localization | Secreted. [UniProt] |
| Calculated MW | 165 kDa (Rat) |
Images (1) Click the Picture to Zoom In
-
ARG59148 anti-MEGF6 antibody WB image
Western blot: Rat lung lysate stained with ARG59148 anti-MEGF6 antibody at 1 µg/ml dilution.
