ARG59338
anti-MGA antibody
anti-MGA antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MGA |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Bov, Dog, Hrs, Mk, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MGA |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 2376-2415 of Human MGA. (QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH) |
| Conjugation | Un-conjugated |
| Alternate Names | MXD5; MAD5; MAX dimerization protein 5; MAX gene-associated protein |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | MGA |
| Gene Full Name | MGA, MAX dimerization protein |
| Function | Functions as a dual-specificity transcription factor, regulating the expression of both MAX-network and T-box family target genes. Functions as a repressor or an activator. Binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence and seems to regulate MYC-MAX target genes. Suppresses transcriptional activation by MYC and inhibits MYC-dependent cell transformation. Function activated by heterodimerization with MAX. This heterodimerization serves the dual function of both generating an E-box-binding heterodimer and simultaneously blocking interaction of a corepressor (By similarity). [UniProt] |
| Cellular Localization | Nucleus. [UniProt] |
| Calculated MW | 336 kDa |
Images (1) Click the Picture to Zoom In
-
ARG59338 anti-MGA antibody WB image
Western blot: HeLa, MCF-7 and SW620 whole cell lysates stained with ARG59338 anti-MGA antibody at 0.5 µg/ml dilution.
