ARG59037

anti-MGST1 antibody

anti-MGST1 antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes MGST1
Tested Reactivity Hu, Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name MGST1
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 42-75 of Human MGST1 (KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA).
Conjugation Un-conjugated
Alternate Names Microsomal GST-1; EC 2.5.1.18; Microsomal glutathione S-transferase 1; MGST; MGST-I; Microsomal GST-I; GST12

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 171341 Rat MGST1

GeneID: 4257 Human MGST1

GeneID: 56615 Mouse MGST1

Gene Symbol MGST1
Gene Full Name microsomal glutathione S-transferase 1
Background The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene. [provided by RefSeq, May 2012]
Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a wide substrate specificity. [UniProt]
Cellular Localization Microsome. Mitochondrion outer membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. [UniProt]
Calculated MW 18 kDa
PTM Peroxynitrite induces nitration at Tyr-93 which activates the enzyme. [UniProt]

Images (1) Click the Picture to Zoom In

  • ARG59037 anti-MGST1 antibody WB image

    Western blot: 50 µg of Rat liver, 50 µg of Mouse liver and 40 µg of HepG2 lysates stained with ARG59037 anti-MGST1 antibody at 0.5 µg/ml dilution.