ARG40422
anti-MMP17 / MT4-MMP antibody
anti-MMP17 / MT4-MMP antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MMP17 / MT4-MMP |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Cow, Hrs |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MMP17 / MT4-MMP |
| Antigen Species | Human |
| Immunogen | Synthetic peptide from Human MMP17 / MT4-MMP. (located within the following region: YPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVC) |
| Conjugation | Un-conjugated |
| Alternate Names | Membrane-type matrix metalloproteinase 4; MT-MMP 4; MT4-MMP; EC 3.4.24.-; MT4MMP; MTMMP4; MMP-17; Membrane-type-4 matrix metalloproteinase; Matrix metalloproteinase-17 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 79%; Horse: 93% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | MMP17 |
| Gene Full Name | matrix metallopeptidase 17 (membrane-inserted) |
| Background | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene is considered a member of the membrane-type MMP (MT-MMP) subfamily. However, this protein is unique among the MT-MMP's in that it is a GPI-anchored protein rather than a transmembrane protein. The protein activates MMP-2 by cleavage. [provided by RefSeq, Jul 2008] |
| Function | Endopeptidase that degrades various components of the extracellular matrix, such as fibrin. May be involved in the activation of membrane-bound precursors of growth factors or inflammatory mediators, such as tumor necrosis factor-alpha. May also be involved in tumoral process. Not obvious if able to proteolytically activate progelatinase A. Does not hydrolyze collagen types I, II, III, IV and V, gelatin, fibronectin, laminin, decorin nor alpha1-antitrypsin. [UniProt] |
| Cellular Localization | Isoform Long: Cell membrane; Lipid-anchor, GPI-anchor; Extracellular side. Secreted, extracellular space, extracellular matrix. [UniProt] |
| Calculated MW | 67 kDa |
| PTM | The precursor is cleaved by a furin endopeptidase. [UniProt] |
Images (1) Click the Picture to Zoom In
