ARG43058
anti-MORC3 antibody
anti-MORC3 antibody for Flow cytometry,ICC/IF,Western blot and Human,Mouse,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes MORC3 |
---|---|
Tested Reactivity | Hu, Ms, Rat |
Tested Application | FACS, ICC/IF, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | MORC3 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to a sequence of Human MORC3. (ESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVD) |
Conjugation | Un-conjugated |
Alternate Names | ZCW5; Zinc finger CW-type coiled-coil domain protein 3; ZCWCC3; NXP2; MORC family CW-type zinc finger protein 3 |
Application Instructions
Application Suggestion |
|
||||||||
---|---|---|---|---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
Preservative | 0.05% Sodium azide |
Stabilizer | 4% Trehalose |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # Q14149 Human MORC family CW-type zinc finger protein 3 |
---|---|
Gene Symbol | MORC3 |
Gene Full Name | MORC family CW-type zinc finger 3 |
Background | This gene encodes a protein that localizes to the nuclear matrix and forms nuclear bodies via an ATP-dependent mechanism. The protein is predicted to have coiled-coil and zinc finger domains and has RNA binding activity. Alternative splicing produces multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2016] |
Function | Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696). Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696). Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504). Binds RNA in vitro (PubMed:11927593). May be required for influenza A transcription during viral infection (PubMed:26202233). [UniProt] |
Cellular Localization | Nucleus, nucleoplasm. Nucleus matrix. Nucleus, PML body. Note=Also found in PML-independent nuclear bodies. Localization to nuclear bodies is ATP-dependent. [UniProt] |
Calculated MW | 107 kDa |
PTM | Sumoylation is involved in interaction with PML and localization to PML nuclear bodies. [UniProt] |
Images (3) Click the Picture to Zoom In
-
ARG43058 anti-MORC3 antibody ICC/IF image
Immunofluorescence: A431 cells were blocked with 10% goat serum and then stained with ARG43058 anti-MORC3 antibody at 2 µg/ml dilution, overnight at 4°C.
-
ARG43058 anti-MORC3 antibody WB image
Western blot: 50 µg of sample under reducing conditions. Rat heart, Rat liver and Mouse heart lysates stained with ARG43058 anti-MORC3 antibody at 0.5 µg/ml dilution, overnight at 4°C.
-
ARG43058 anti-MORC3 antibody FACS image
Flow Cytometry: A431 cells were blocked with 10% normal goat serum and then stained with ARG43058 anti-MORC3 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.