ARG42963

anti-MRP2 antibody

anti-MRP2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse

Overview

Product Description Rabbit Polyclonal antibody recognizes MRP2
Tested Reactivity Hu, Ms
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name MRP2
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human MRP2. (AIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD)
Conjugation Un-conjugated
Alternate Names DJS; ATP-binding cassette sub-family C member 2; CMOAT; ABC30; cMRP; Canalicular multidrug resistance protein; MRP2; Canalicular multispecific organic anion transporter 1; Multidrug resistance-associated protein 2

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P1:200 - 1:1000
WB1:500 - 1:2000
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 210 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 1244 Human ABCC2

GeneID: 12780 Mouse ABCC2

Swiss-port # Q8VI47 Mouse Canalicular multispecific organic anion transporter 1

Swiss-port # Q92887 Human Canalicular multispecific organic anion transporter 1

Gene Symbol ABCC2
Gene Full Name ATP-binding cassette, sub-family C (CFTR/MRP), member 2
Background The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq, Jul 2008]
Function Mediates hepatobiliary excretion of numerous organic anions and conjugated organic anions such as methotrexate, 17beta-estradiol 17-glucosiduronic acid and leukotriene C4 (PubMed:11500505). Also transports sulfated bile salt such as taurolithocholate sulfate (PubMed:16332456). May function as a cellular cisplatin transporter. [UniProt]
Cellular Localization Apical cell membrane; Multi-pass membrane protein. [UniProt]
Calculated MW 174 kDa

Images (7) Click the Picture to Zoom In

  • ARG42963 anti-MRP2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human liver cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42963 anti-MRP2 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG42963 anti-MRP2 antibody WB image

    Western blot: 50 µg of sample under reducing conditions. Caco-2 whole cell lysate stained with ARG42963 anti-MRP2 antibody at 0.5 µg/ml dilution, overnight at 4°C.

  • ARG42963 anti-MRP2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42963 anti-MRP2 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG42963 anti-MRP2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human rectal cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42963 anti-MRP2 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG42963 anti-MRP2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Mouse kidney tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42963 anti-MRP2 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG42963 anti-MRP2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human mammary cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42963 anti-MRP2 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG42963 anti-MRP2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Mouse liver tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42963 anti-MRP2 antibody at 1 µg/ml dilution, overnight at 4°C.