ARG10823
anti-MTF6 antibody
anti-MTF6 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MTF6 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Goat, Gpig, Hrs, Rb, Sheep, Zfsh |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MTF6 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminus of Human MYF6. (PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA) |
| Conjugation | Un-conjugated |
| Alternate Names | Muscle-specific regulatory factor 4; Myf-6; bHLHc4; myf-6; Class C basic helix-loop-helix protein 4; MRF4; Myogenic factor 6; CNM3 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | Fetal heart. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | MYF6 |
| Gene Full Name | myogenic factor 6 (herculin) |
| Background | The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM). [provided by RefSeq, May 2010] |
| Function | Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein. [UniProt] |
| Calculated MW | 27 kDa |
Images (3) Click the Picture to Zoom In
-
ARG10823 anti-MTF6 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human intestine stained with ARG10823 anti-MTF6 antibody.
Magnification: 400X
-
ARG10823 anti-MTF6 antibody WB image
Western blot: Human heart lysaste stained with ARG10823 anti-MTF6 antibody.
-
ARG10823 anti-MTF6 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human pancreas stained with ARG10823 anti-MTF6 antibody.
Magnification: 400X
Customer's Feedback
Excellent
Review for anti-MTF6 antibody
Application：WB
Sample：293T
Sample Loading Amount：20 µg
Primary Antibody Dilution Factor：1:500
Primary Antibody Incubation Time：overnight
Primary Antibody Incubation Temperature：4 ºC
