ARG40996
anti-MUC3 antibody
anti-MUC3 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes MUC3 |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | MUC3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence around the C-terminus of Human MUC3 (DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK). |
| Conjugation | Un-conjugated |
| Alternate Names | MUC3; MUC3A; MUC3B; Mucin-3A; Mucin-3B |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Gene Symbol | MUC3B |
|---|---|
| Gene Full Name | mucin 3B, cell surface associated |
| Function | Major glycoprotein component of a variety of mucus gels. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces (By similarity). [UniProt] |
| Calculated MW | 131 kDa |
Images (1) Click the Picture to Zoom In
-
ARG40996 anti-MUC3 antibody WB image
Western blot: SW620 and COLO320 whole cell lysates stained with ARG40996 anti-MUC3 antibody at 0.5 µg/ml dilution.
