ARG23706
anti-NFIA antibody
anti-NFIA antibody for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes NFIA |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | NFIA |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around aa. 180-224 of Human NFIA. (AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) |
| Conjugation | Un-conjugated |
| Alternate Names | Nuclear factor 1/A; Nuclear factor 1 A-type; TGGCA-binding protein; NF-I/A; NF1-A; CTF; CCAAT-box-binding transcription factor; NFI-L; Nuclear factor I/A; NFI-A |
Application Instructions
| Application Suggestion |
|
||||||||
|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Steam tissue section in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | PBS, 0.025% Sodium azide and 2.5% BSA. |
| Preservative | 0.025% Sodium azide |
| Stabilizer | 2.5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | NFIA |
| Gene Full Name | nuclear factor I/A |
| Background | This gene encodes a member of the NF1 (nuclear factor 1) family of transcription factors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
| Function | Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [UniProt] |
| Calculated MW | 56 kDa (unmodified); 60-70 kDa (phosphorylated) |
Images (6) Click the Picture to Zoom In
-
ARG23706 anti-NFIA antibody FACS image
Flow Cytometry: Human K562 cells stained with ARG23706 anti-NFIA antibody at 1 µg/10^6 cells (blocked with Goat sera).
Red: Cells alone
Green: Isotype control
Blue: Primary antibody. -
ARG23706 anti-NFIA antibody IHC-P image
Immunohistochemistry: Formalin-fixed and paraffin-embedded Human breast cancer tissue stained with ARG23706 anti-NFIA antibody at 1 µg/ml dilution. Antigen Retrieval: Steam tissue section in Citrate buffer (pH 6.0) for 20 min.
-
ARG23706 anti-NFIA antibody WB image
Western blot: 1) Jurkat and 2) COLO320 cell lysates stained with ARG23706 anti-NFIA antibody at 0.5 µg/ml dilution.
-
ARG23706 anti-NFIA antibody IHC-P image
Immunohistochemistry: Formalin-fixed and paraffin-embedded Mouse liver stained with ARG23706 anti-NFIA antibody at 1 µg/ml dilution. Antigen Retrieval: Steam tissue section in Citrate buffer (pH 6.0) for 20 min.
-
ARG23706 anti-NFIA antibody IHC-P image
Immunohistochemistry: Formalin-fixed and paraffin-embedded Rat liver stained with ARG23706 anti-NFIA antibody at 1 µg/ml dilution. Antigen Retrieval: Steam tissue section in Citrate buffer (pH 6.0) for 20 min.
-
ARG23706 anti-NFIA antibody WB image
Western blot: 1) HEPA1-6 and 2) SP2/0 cell lysates stained with ARG23706 anti-NFIA antibody at 0.5 µg/ml dilution.
