ARG59017

anti-NFIB / NF1B2 antibody

anti-NFIB / NF1B2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes NFIB / NF1B2
Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name NFIB / NF1B2
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human NFIB / NF1B2 (ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR).
Conjugation Un-conjugated
Alternate Names NFI-RED; Nuclear factor 1/B; HMGIC/NFIB; TGGCA-binding protein; Nuclear factor 1 B-type; NF-I/B; NF1-B; CTF; CCAAT-box-binding transcription factor; NFI-B; NFIB2; NFIB3; Nuclear factor I/B

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 18028 Mouse NFIB

GeneID: 4781 Human NFIB

Swiss-port # O00712 Human Nuclear factor 1 B-type

Swiss-port # P97863 Mouse Nuclear factor 1 B-type

Gene Symbol NFIB
Gene Full Name nuclear factor I/B
Function Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 47 kDa

Images (4) Click the Picture to Zoom In

  • ARG59017 anti-NFIB / NF1B2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human mammary cancer tissue. Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59017 anti-NFIB / NF1B2 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG59017 anti-NFIB / NF1B2 antibody WB image

    Western blot: 50 µg of samples under reducing conditions. HeLa, PC-12, Mouse lung, Mouse ovary and HEPA1-6 lysates stained with ARG59017 anti-NFIB / NF1B2 antibody at 0.5 µg/ml, overnight at 4°C.

  • ARG59017 anti-NFIB / NF1B2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Mouse lung tissue. Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59017 anti-NFIB / NF1B2 antibody at 1 µg/ml dilution, overnight at 4°C.

  • ARG59017 anti-NFIB / NF1B2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Rat cardiac muscle tissue. Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59017 anti-NFIB / NF1B2 antibody at 1 µg/ml dilution, overnight at 4°C.