ARG40189
anti-NLRP1 / NALP1 antibody
anti-NLRP1 / NALP1 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes NLRP1 / NALP1 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | NLRP1 / NALP1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human NLRP1 / NALP1. (Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL) |
| Conjugation | Un-conjugated |
| Alternate Names | NAC; PP1044; DEFCAP; SLEV1; VAMAS1; Nucleotide-binding domain and caspase recruitment domain; DEFCAP-L/S; NALP1; NACHT, LRR and PYD domains-containing protein 1; Death effector filament-forming ced-4-like apoptosis protein; CLR17.1; Caspase recruitment domain-containing protein 7; CIDED; CARD7 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 85%; Dog: 86%; Guinea Pig: 85%; Horse: 85%; Mouse: 93%; Pig: 86%; Rabbit: 85%; Rat: 100% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | NCI-H226 |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q9C000 Human NACHT, LRR and PYD domains-containing protein 1 |
|---|---|
| Gene Symbol | NLRP1 |
| Gene Full Name | NLR family, pyrin domain containing 1 |
| Background | This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like motif, which is possibly involved in protein-protein interactions. This protein interacts strongly with caspase 2 and weakly with caspase 9. Overexpression of this gene was demonstrated to induce apoptosis in cells. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008] |
| Function | Able to form cytoplasmic structures termed death effector filaments. Enhances APAF1 and cytochrome c-dependent activation of pro-caspase-9 and consecutive apoptosis. Stimulates apoptosis through activation of caspase-3. Involved in activation of caspase-1 and caspase-5 as part of the NALP1 inflammasome complex which leads to processing and release of IL1B and IL18. Binds ATP. [UniProt] |
| Cellular Localization | Cytoplasm, cytosol. Cytoplasm. Inflammasome. Nucleus. Note=Nucleocytoplasmic distribution in lymphoid organs (probably in T-cells) and in neurons. In epithelial cells, predominantly cytoplasmic. [UniProt] |
| Calculated MW | 166 kDa |
Images (1) Click the Picture to Zoom In
