ARG41407
anti-NOXO1 antibody
anti-NOXO1 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes NOXO1 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Cow, Hrs |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | NOXO1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide derived from Human NOXO1. (within the following region: HSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDR) |
| Conjugation | Un-conjugated |
| Alternate Names | NADPH oxidase regulatory protein; Nox organizer 1; SH3PXD5; P41NOX; Nox-organizing protein 1; SNX28; NADPH oxidase organizer 1; P41NOXC; P41NOXB; P41NOXA; SH3 and PX domain-containing protein 5 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 77%; Horse: 77% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human kidney | ||||
| Observed Size | 40 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | NOXO1 |
| Gene Full Name | NADPH oxidase organizer 1 |
| Background | This gene encodes an NADPH oxidase (NOX) organizer, which positively regulates NOX1 and NOX3. The protein contains a PX domain and two SH3 domains. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2012] |
| Function | Constitutively potentiates the superoxide-generating activity of NOX1 and NOX3 and is required for the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity. Isoform 3 is more potent than isoform 1 in activating NOX3. Together with NOXA1, may also substitute to NCF1/p47phox and NCF2/p67phox in supporting the phagocyte NOX2/gp91phox superoxide-generating activity. [UniProt] |
| Cellular Localization | Isoform 3: Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note=Isoform 3 associates with the plasma membrane in a lipid-dependent manner (PubMed:12716910). [UniProt] |
| Calculated MW | 41 kDa |
Images (1) Click the Picture to Zoom In
-
ARG41407 anti-NOXO1 antibody WB image
Western blot: Human kidney lysate stained with ARG41407 anti-NOXO1 antibody at 1 µg/ml dilution.
