ARG59039

anti-NR3C2 / Mineralocorticoid Receptor antibody

anti-NR3C2 / Mineralocorticoid Receptor antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes NR3C2 / Mineralocorticoid Receptor
Tested Reactivity Hu, Ms, Rat
Predict Reactivity Chk
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name NR3C2 / Mineralocorticoid Receptor
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 950-984 of Human NR3C2 (HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK).
Conjugation Un-conjugated
Alternate Names NR3C2VIT; MR; MLR; Nuclear receptor subfamily 3 group C member 2; Mineralocorticoid receptor; MCR

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 25672 Rat NR3C2

GeneID: 4306 Human NR3C2

Swiss-port # P08235 Human Mineralocorticoid receptor

Swiss-port # P22199 Rat Mineralocorticoid receptor

Gene Symbol NR3C2
Gene Full Name nuclear receptor subfamily 3, group C, member 2
Background This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Function Receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. Binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion and water transport and thus raise extracellular fluid volume and blood pressure and lower potassium levels. [UniProt]
Cellular Localization Cytoplasm. Nucleus. Endoplasmic reticulum membrane; Peripheral membrane protein. Cytoplasmic and nuclear in the absence of ligand; nuclear after ligand-binding. When bound to HSD11B2, it is found associated with the endoplasmic reticulum membrane. [UniProt]
Calculated MW 107 kDa
PTM Phosphorylated. [UniProt]

Images (2) Click the Picture to Zoom In

  • ARG59039 anti-NR3C2 / Mineralocorticoid Receptor antibody WB image

    Western blot: 50 µg of samples under reducing conditions. Rat kidney, Mouse kidney, HeLa and A431 lysates stained with ARG59039 anti-NR3C2 / Mineralocorticoid Receptor antibody at 0.5 µg/ml, overnight at 4°C.

  • ARG59039 anti-NR3C2 / Mineralocorticoid Receptor antibody WB image

    Western blot: 50 µg of samples under reducing conditions. Mouse brain and Rat brain lysates stained with ARG59039 anti-NR3C2 / Mineralocorticoid Receptor antibody at 0.5 µg/ml, overnight at 4°C.